PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc06870.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 240aa    MW: 25666.5 Da    PI: 6.8839
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc06870.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF59.83.3e-193781145
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                  kri ++ +rqv fskR+ g++KKA+ LS LC+a vav+ fs+ gk
  Zpz_sc06870.1.g00010.1.am.mk 37 KRIASEEKRQVCFSKRKDGLFKKASDLSALCGAHVAVVAFSPGGK 81
                                  79****************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-292988IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-2629100IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.1932989IPR002100Transcription factor, MADS-box
CDDcd002651.15E-3330105No hitNo description
PRINTSPR004041.1E-173151IPR002100Transcription factor, MADS-box
PfamPF003194.8E-243885IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-175166IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-176687IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MASRDHSDVS LEAAPAAVMT IERKRKKTMG RQKIEIKRIA SEEKRQVCFS KRKDGLFKKA  60
SDLSALCGAH VAVVAFSPGG KPFSFGHPSV DALVGRFTDP AAPGAMGPAP VHSALLEEFS  120
REEELLAKAL AAEASRKKAL EAAICQAGVW TGDADVKSAS PNDVLAMRSA LERVQAEVAE  180
RLQEFMAEEA MMQLTASAGL FVADGGVSSH HRDQVVMDEQ KMMAMGGNVD HALPFAAMML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-1629121190Myocyte-specific enhancer factor 2B
1tqe_Q1e-1629121190Myocyte-specific enhancer factor 2B
1tqe_R1e-1629121190Myocyte-specific enhancer factor 2B
1tqe_S1e-1629121190Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12226RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451595.14e-51hypothetical protein SORBIDRAFT_04g004410
TrEMBLC5XVH44e-51C5XVH4_SORBI; Putative uncharacterized protein Sb04g004410
STRINGSb04g004410.11e-50(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-26AGAMOUS-like 62